(data stored in ACNUC27125 zone)

EMBL: CP000828.PE18

CP000828.PE18        Location/Qualifiers
FT   CDS             complement(20343..21668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0020"
FT                   /product="PhoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25109"
FT                   /db_xref="GOA:B0C4Z7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Z7"
FT                   /protein_id="ABW25109.1"
FT                   /translation="MKKAFVLDTNVLLHDPNAIFRFEDNDVVLPITIIEELDRFKKQPQ
FT                   ETGRNARQVSRTLDDLRAQGQLTKGIELPKGGTIRVALCDRITLNELPPELEGDQADNA
FT                   ILAVALELKNQCQCPVALVSKDTNLRIKADVLGLAAEDYSTDKVDFEGLYTGMTSVMVG
FT                   SDTISQLFQSGQTTLAEKTWPNQAVTLVDSLKPSHTALALAGDHTGEVMPLPKFPHNGI
FT                   SRIRARNREQKFAFELLMRDDIALVTLVGKAGTGKTLIAIAAGLHKVADEKNYSRLLIA
FT                   RPVVPMGRDLGYLPGDIDEKLTPWMQPLYDNFDLIFGTQEAAGQPQHWRRGHEELMDQG
FT                   LLQIEPLTYIRGRTIPKQFLIVDEAQNLTPHEVKTILTRAGEDTKVVLTGDPEQIDNPY
FT                   VDAASNGLTYVVERFKSESIAGHITLYQGERSDLAERAAALL"
     MKKAFVLDTN VLLHDPNAIF RFEDNDVVLP ITIIEELDRF KKQPQETGRN ARQVSRTLDD        60
     LRAQGQLTKG IELPKGGTIR VALCDRITLN ELPPELEGDQ ADNAILAVAL ELKNQCQCPV       120
     ALVSKDTNLR IKADVLGLAA EDYSTDKVDF EGLYTGMTSV MVGSDTISQL FQSGQTTLAE       180
     KTWPNQAVTL VDSLKPSHTA LALAGDHTGE VMPLPKFPHN GISRIRARNR EQKFAFELLM       240
     RDDIALVTLV GKAGTGKTLI AIAAGLHKVA DEKNYSRLLI ARPVVPMGRD LGYLPGDIDE       300
     KLTPWMQPLY DNFDLIFGTQ EAAGQPQHWR RGHEELMDQG LLQIEPLTYI RGRTIPKQFL       360
     IVDEAQNLTP HEVKTILTRA GEDTKVVLTG DPEQIDNPYV DAASNGLTYV VERFKSESIA       420
     GHITLYQGER SDLAERAAAL L                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page