(data stored in ACNUC8465 zone)

EMBL: CP000828.PE186

CP000828.PE186       Location/Qualifiers
FT   CDS             complement(191849..192307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25277"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7L7"
FT                   /protein_id="ABW25277.1"
FT                   /translation="MTSTAVTARPCLATVAASDANNVWIAYNGPEFLGRIYKDFSGNFY
FT                   YELGRSISQRFGSKQDALFSLYETTERANQQHQKQISSELESITENWGHVAVPGSANAR
FT                   RIPNVGCKRPKVLTHAKPSTQTKPSHTQTVIIGRTECVKTKHGLIAID"
     MTSTAVTARP CLATVAASDA NNVWIAYNGP EFLGRIYKDF SGNFYYELGR SISQRFGSKQ        60
     DALFSLYETT ERANQQHQKQ ISSELESITE NWGHVAVPGS ANARRIPNVG CKRPKVLTHA       120
     KPSTQTKPSH TQTVIIGRTE CVKTKHGLIA ID                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page