(data stored in ACNUC27125 zone)

EMBL: CP000828.PE19

CP000828.PE19        Location/Qualifiers
FT   CDS             complement(21929..22390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Z8"
FT                   /protein_id="ABW25110.1"
FT                   /translation="MKSKVLMPLLLLAVLGVPVRVMAHALETNYVLEEVNKVQFTAVFS
FT                   TGEPHKKAKVKIYSPDNLTEPVMETETDENGQFTFDTSEKMPGEWEVSIGESGHQDILT
FT                   VPVTPKGININEISEVPQHQSPQIPLVAIVLSGGMGSAAVLSRKLRSIK"
     MKSKVLMPLL LLAVLGVPVR VMAHALETNY VLEEVNKVQF TAVFSTGEPH KKAKVKIYSP        60
     DNLTEPVMET ETDENGQFTF DTSEKMPGEW EVSIGESGHQ DILTVPVTPK GININEISEV       120
     PQHQSPQIPL VAIVLSGGMG SAAVLSRKLR SIK                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page