(data stored in ACNUC8465 zone)

EMBL: CP000828.PE195

CP000828.PE195       Location/Qualifiers
FT   CDS             200872..201048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25286"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7M6"
FT                   /protein_id="ABW25286.1"
FT                   /translation="MVERLSAFSLGKAEVAGHIRGTDQTSSQMLQATVPDSCSLQTGWL
FT                   LIGECQLWINQTL"
     MVERLSAFSL GKAEVAGHIR GTDQTSSQML QATVPDSCSL QTGWLLIGEC QLWINQTL          58
//

If you have problems or comments...

PBIL Back to PBIL home page