(data stored in ACNUC5340 zone)

EMBL: CP000828.PE196

CP000828.PE196       Location/Qualifiers
FT   CDS             complement(201259..202194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7M7"
FT                   /protein_id="ABW25287.1"
FT                   /translation="MLGKMIANTFIKPYQSPVFDDPKNYGLDYEAVTFSAKDGVELSGW
FT                   LIKGSTNKVIIQSHFGVQCSRSGYTREGKGFIKGWDEDVRFLRQAKYLNEAGYSVLMYD
FT                   MRNHGKSSLGTLPYISWGKEEAKDVLAAVDFMTNHGTYKDAEIGLLSICMGQGASVAAF
FT                   GMENGLKQYENIKCMISVQPMDYTCFVNAMGLPNFLVDSTTKSIKKQTGEDFNELTWRP
FT                   FVKDITVPTLIIQNMNDSYLNEEFLNELYEELNVEKEILLLDLPKMKNALQNRMACYNW
FT                   IGENSEPILSWFNKYLAAPKLKSSVPSSQN"
     MLGKMIANTF IKPYQSPVFD DPKNYGLDYE AVTFSAKDGV ELSGWLIKGS TNKVIIQSHF        60
     GVQCSRSGYT REGKGFIKGW DEDVRFLRQA KYLNEAGYSV LMYDMRNHGK SSLGTLPYIS       120
     WGKEEAKDVL AAVDFMTNHG TYKDAEIGLL SICMGQGASV AAFGMENGLK QYENIKCMIS       180
     VQPMDYTCFV NAMGLPNFLV DSTTKSIKKQ TGEDFNELTW RPFVKDITVP TLIIQNMNDS       240
     YLNEEFLNEL YEELNVEKEI LLLDLPKMKN ALQNRMACYN WIGENSEPIL SWFNKYLAAP       300
     KLKSSVPSSQ N                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page