(data stored in ACNUC27125 zone)

EMBL: CP000828.PE202

CP000828.PE202       Location/Qualifiers
FT   CDS             206019..206150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25293"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7N3"
FT                   /protein_id="ABW25293.1"
FT                   /translation="MLLVAELETIIKMCFDILKIDGYWVDEVFLSRGQIAISAMFLS"
     MLLVAELETI IKMCFDILKI DGYWVDEVFL SRGQIAISAM FLS                          43
//

If you have problems or comments...

PBIL Back to PBIL home page