(data stored in ACNUC5340 zone)

EMBL: CP000828.PE206

CP000828.PE206       Location/Qualifiers
FT   CDS             208739..209440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0211"
FT                   /product="cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25297"
FT                   /db_xref="GOA:B0C7N7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7N7"
FT                   /protein_id="ABW25297.1"
FT                   /translation="MKATVEQLAGLSLFAELRPQDLETLQPHTQIRTYRKEEILIHEGD
FT                   LIPEKLHVLFKGVLQVVKSSATGKETILRRLRAGDIFAAPALFGDALAPATVLAIEDCQ
FT                   VLTIDRADLLRAIQEAPELALSILVVFNQRLQQLHKMVHGLVSERAVVRLAQLIQYSAL
FT                   QHGTKVTEAGEQLQIKLPYYQMARSIGITYEECARLMKGLHAVVAYQRGGKIVILDPEE
FT                   LTAIAEGQKEI"
     MKATVEQLAG LSLFAELRPQ DLETLQPHTQ IRTYRKEEIL IHEGDLIPEK LHVLFKGVLQ        60
     VVKSSATGKE TILRRLRAGD IFAAPALFGD ALAPATVLAI EDCQVLTIDR ADLLRAIQEA       120
     PELALSILVV FNQRLQQLHK MVHGLVSERA VVRLAQLIQY SALQHGTKVT EAGEQLQIKL       180
     PYYQMARSIG ITYEECARLM KGLHAVVAYQ RGGKIVILDP EELTAIAEGQ KEI              233
//

If you have problems or comments...

PBIL Back to PBIL home page