(data stored in ACNUC27125 zone)

EMBL: CP000828.PE207

CP000828.PE207       Location/Qualifiers
FT   CDS             209523..209969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0212"
FT                   /product="globin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25298"
FT                   /db_xref="GOA:B0C7N8"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7N8"
FT                   /protein_id="ABW25298.1"
FT                   /translation="MALQTELLTNSFDLLRENEAEFTQVFYGTLFTDYPQVKPLFSNTH
FT                   MDEQAKKLFASLLLVVNNLTKPDALSSALKGLGTRHVKYGVLPEHYPLVGSTLLKSMAA
FT                   TLKDQWTPDIEAAWTDAYGAITEIMLEGTDYPEEVLISESMSAT"
     MALQTELLTN SFDLLRENEA EFTQVFYGTL FTDYPQVKPL FSNTHMDEQA KKLFASLLLV        60
     VNNLTKPDAL SSALKGLGTR HVKYGVLPEH YPLVGSTLLK SMAATLKDQW TPDIEAAWTD       120
     AYGAITEIML EGTDYPEEVL ISESMSAT                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page