(data stored in ACNUC5340 zone)

EMBL: CP000828.PE211

CP000828.PE211       Location/Qualifiers
FT   CDS             211933..212049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25302"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE5"
FT                   /protein_id="ABW25302.1"
FT                   /translation="MSPLEKELLPIDETEVFPENDELEIVDLDDLLKELQQD"
     MSPLEKELLP IDETEVFPEN DELEIVDLDD LLKELQQD                                38
//

If you have problems or comments...

PBIL Back to PBIL home page