(data stored in ACNUC27125 zone)

EMBL: CP000828.PE212

CP000828.PE212       Location/Qualifiers
FT   CDS             212154..212531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25303"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7P3"
FT                   /protein_id="ABW25303.1"
FT                   /translation="MVDLVLEIARDRTTDPHKIATWMVTTSTSICHATFGTNDPMPLLS
FT                   LYIRALDTQYPATMQEIYQILANEGLVKYAPSSLKRDDFTSILWAAGSTFANGELKLIE
FT                   DKIYISPQGLQRLRSIWKAPT"
     MVDLVLEIAR DRTTDPHKIA TWMVTTSTSI CHATFGTNDP MPLLSLYIRA LDTQYPATMQ        60
     EIYQILANEG LVKYAPSSLK RDDFTSILWA AGSTFANGEL KLIEDKIYIS PQGLQRLRSI       120
     WKAPT                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page