(data stored in ACNUC27125 zone)

EMBL: CP000828.PE213

CP000828.PE213       Location/Qualifiers
FT   CDS             complement(213921..214634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0218"
FT                   /product="EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25304"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7P4"
FT                   /protein_id="ABW25304.1"
FT                   /translation="MAFQPIVNLADGSIFAQEALARGMNNESAISILEQVTDENLYRFD
FT                   QACRVQAIQLAAELDIQSILSINFLPNAVYHPELCLQTTLETAERCNFPISRILFELTE
FT                   VEKVIDYAHVQSIIKHYQKLGFRTALDDFGAGYSGFNFLADFRPDFIKIDMALIRNIDK
FT                   DKARQAIVRGIVQVCRDLAIEPIAEGIETDLELDVLRELGLQLFQGYYFAKPSFRAVTT
FT                   DLSFARSNPNLHKND"
     MAFQPIVNLA DGSIFAQEAL ARGMNNESAI SILEQVTDEN LYRFDQACRV QAIQLAAELD        60
     IQSILSINFL PNAVYHPELC LQTTLETAER CNFPISRILF ELTEVEKVID YAHVQSIIKH       120
     YQKLGFRTAL DDFGAGYSGF NFLADFRPDF IKIDMALIRN IDKDKARQAI VRGIVQVCRD       180
     LAIEPIAEGI ETDLELDVLR ELGLQLFQGY YFAKPSFRAV TTDLSFARSN PNLHKND          237
//

If you have problems or comments...

PBIL Back to PBIL home page