(data stored in ACNUC8465 zone)

EMBL: CP000828.PE215

CP000828.PE215       Location/Qualifiers
FT   CDS             215132..217399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0220"
FT                   /product="two-component hybrid sensor and regulator
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25306"
FT                   /db_xref="GOA:B0C7P6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7P6"
FT                   /protein_id="ABW25306.1"
FT                   /translation="MFKLLRYYSITSFVAFVVAIAALNQYTRDRAIQSLVTVTENKNVA
FT                   LTQSFANTLWKTHGSFLSNTQSLTAKQLKSHPQTLKLTKDIESWAEGLPVLKVKVFDTQ
FT                   GRTVFSTSTKQIGQDKRQSKGFQAAIQGQSRSFINHKDTFTGMKGQMKDRNLLSSYLPL
FT                   RPDGPDGSIEGVFEMYTDVTPLLERVETTQRNILWGTSGVLGLLYGVLFAIVYRGDRII
FT                   QEKHAAAAAAARAKDDFLAMMSHEIRTPMNGVIGMTGLLLDTELTPQQQEYTETIRKSG
FT                   DSLLTLINDILDYSKIEAGKLDLEKQAFNVRVCVEDALELVASRVGPKEIELAGVVEPD
FT                   VPQAILGDVTRLRQILVNLLGNAIKFTQSGEVVVNVSAEPFAADTPLYELSFAVRDTGM
FT                   GIPAERQNRLFKSFSQVDSSTTRKFGGTGLGLVICKRLSELMGGRIWVESEEGQGSTFA
FT                   FTIQAEETEDTTVLAQSLPAVTLKDKRVLLVDDNDTNQRVLTLQTESWKMKPQVAASGY
FT                   EALGLLEHAGPFDIAILDMQMPEMDGLTLAQKIRSHPRGVNFPMVMLTSIGQAPDLAHH
FT                   KGLFSAWLNKPIKQSQLYSALVKSLTGNEVKTQKSTTLQLDTEMADQHPLKILLAEDNP
FT                   VNQKLAVLILAKMGYRPDVVGNGLEVLQALKRQSYDVILMDVNMPEMDGLTATTHIYQS
FT                   IMPEERPRIIAMTANAMQGDREKCLDVGMDDYVTKPINIQELVVALENSEPQTTESQPI
FT                   KT"
     MFKLLRYYSI TSFVAFVVAI AALNQYTRDR AIQSLVTVTE NKNVALTQSF ANTLWKTHGS        60
     FLSNTQSLTA KQLKSHPQTL KLTKDIESWA EGLPVLKVKV FDTQGRTVFS TSTKQIGQDK       120
     RQSKGFQAAI QGQSRSFINH KDTFTGMKGQ MKDRNLLSSY LPLRPDGPDG SIEGVFEMYT       180
     DVTPLLERVE TTQRNILWGT SGVLGLLYGV LFAIVYRGDR IIQEKHAAAA AAARAKDDFL       240
     AMMSHEIRTP MNGVIGMTGL LLDTELTPQQ QEYTETIRKS GDSLLTLIND ILDYSKIEAG       300
     KLDLEKQAFN VRVCVEDALE LVASRVGPKE IELAGVVEPD VPQAILGDVT RLRQILVNLL       360
     GNAIKFTQSG EVVVNVSAEP FAADTPLYEL SFAVRDTGMG IPAERQNRLF KSFSQVDSST       420
     TRKFGGTGLG LVICKRLSEL MGGRIWVESE EGQGSTFAFT IQAEETEDTT VLAQSLPAVT       480
     LKDKRVLLVD DNDTNQRVLT LQTESWKMKP QVAASGYEAL GLLEHAGPFD IAILDMQMPE       540
     MDGLTLAQKI RSHPRGVNFP MVMLTSIGQA PDLAHHKGLF SAWLNKPIKQ SQLYSALVKS       600
     LTGNEVKTQK STTLQLDTEM ADQHPLKILL AEDNPVNQKL AVLILAKMGY RPDVVGNGLE       660
     VLQALKRQSY DVILMDVNMP EMDGLTATTH IYQSIMPEER PRIIAMTANA MQGDREKCLD       720
     VGMDDYVTKP INIQELVVAL ENSEPQTTES QPIKT                                  755
//

If you have problems or comments...

PBIL Back to PBIL home page