(data stored in ACNUC5340 zone)

EMBL: CP000828.PE216

CP000828.PE216       Location/Qualifiers
FT   CDS             complement(217595..218452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0221"
FT                   /product="TPR domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25307"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7P7"
FT                   /protein_id="ABW25307.1"
FT                   /translation="MSDSCFLEPHQDLYSICLQQLLPIASERVQSVDLDWWNIESFLGL
FT                   AFHILLSETDSKLRSQVAQIIPLFGAKAVPNLVFIEQEHVLDADLKSLVNLTFSKIEPQ
FT                   QQVMGLIDMLKACEDQSLDYLIAQKLWEIGAVATEAVATLLADPDEQELALRLLAQFQQ
FT                   FHHQQVANLEALFEHSPDFDPPGSYGAIKQKAETLLKAAMQAESAAPRQAVALYTEALQ
FT                   LCSDHAQAYGSRGLLRAILGDPQGAMADFQAAAELFREQGKTANAEIALGYCKAMARQL
FT                   PHLD"
     MSDSCFLEPH QDLYSICLQQ LLPIASERVQ SVDLDWWNIE SFLGLAFHIL LSETDSKLRS        60
     QVAQIIPLFG AKAVPNLVFI EQEHVLDADL KSLVNLTFSK IEPQQQVMGL IDMLKACEDQ       120
     SLDYLIAQKL WEIGAVATEA VATLLADPDE QELALRLLAQ FQQFHHQQVA NLEALFEHSP       180
     DFDPPGSYGA IKQKAETLLK AAMQAESAAP RQAVALYTEA LQLCSDHAQA YGSRGLLRAI       240
     LGDPQGAMAD FQAAAELFRE QGKTANAEIA LGYCKAMARQ LPHLD                       285
//

If you have problems or comments...

PBIL Back to PBIL home page