(data stored in ACNUC8465 zone)

EMBL: CP000828.PE222

CP000828.PE222       Location/Qualifiers
FT   CDS             225836..226582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0227"
FT                   /product="FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25313"
FT                   /db_xref="GOA:B0C7Q3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7Q3"
FT                   /protein_id="ABW25313.1"
FT                   /translation="MKKIKSEACEHHLLVIDDGKERRIVKLTEVAYSIGRDATNAIVLN
FT                   NPSISRQHAMLVRVPLPHQAHRYRIIDGNSQGKPSANGIYINGRPSSTRELETKDLINF
FT                   GKDIKATYLTLEMGQVELLNYIESLSYKSLKSDTLDHKATVFNSANVPVAELNTVLACH
FT                   HSPTPEQDHDSLQQAPLQAKETVRLSREEILKELNKPVSRQMWMVIAGAILSFCTLIGW
FT                   LMLDARKSSPALEFTQAPSSLGDARL"
     MKKIKSEACE HHLLVIDDGK ERRIVKLTEV AYSIGRDATN AIVLNNPSIS RQHAMLVRVP        60
     LPHQAHRYRI IDGNSQGKPS ANGIYINGRP SSTRELETKD LINFGKDIKA TYLTLEMGQV       120
     ELLNYIESLS YKSLKSDTLD HKATVFNSAN VPVAELNTVL ACHHSPTPEQ DHDSLQQAPL       180
     QAKETVRLSR EEILKELNKP VSRQMWMVIA GAILSFCTLI GWLMLDARKS SPALEFTQAP       240
     SSLGDARL                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page