(data stored in ACNUC27125 zone)

EMBL: CP000828.PE224

CP000828.PE224       Location/Qualifiers
FT   CDS             complement(227133..227450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25315"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7Q5"
FT                   /protein_id="ABW25315.1"
FT                   /translation="MLQVTDISVFFQKNTSNIPDDHFETPKKITVIESWTAIRKGKSAV
FT                   IKGRLLGHPDYPDGVKMMTSTVHRYLAGDGHVYIKTQNSLYELGQPLKTTDFQKLERMT
FT                   Q"
     MLQVTDISVF FQKNTSNIPD DHFETPKKIT VIESWTAIRK GKSAVIKGRL LGHPDYPDGV        60
     KMMTSTVHRY LAGDGHVYIK TQNSLYELGQ PLKTTDFQKL ERMTQ                       105
//

If you have problems or comments...

PBIL Back to PBIL home page