(data stored in ACNUC8465 zone)

EMBL: CP000828.PE226

CP000828.PE226       Location/Qualifiers
FT   CDS             complement(228005..228685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25317"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7Q7"
FT                   /protein_id="ABW25317.1"
FT                   /translation="MSGLPSSSFAQLSTQKTLDIYRYHGLKPAIGQASKDGIFQDFKLQ
FT                   SDNLAKIWADPDAEQHEGLDNSWVKSFIDRQGTLPHLSIQFSREGYGANISIAPKRLIP
FT                   ERLPKQSLLTFEARSSDPVCIGLRLMERDGEVWGYGNPGLEYQPLCVSSNQEWTTFKAP
FT                   LSAQHPGWFHFPHSGNVDLGNQTLDADILALVTLELGLKGDGHLISGQAVLDIRNMRVQ
FT                   PDSP"
     MSGLPSSSFA QLSTQKTLDI YRYHGLKPAI GQASKDGIFQ DFKLQSDNLA KIWADPDAEQ        60
     HEGLDNSWVK SFIDRQGTLP HLSIQFSREG YGANISIAPK RLIPERLPKQ SLLTFEARSS       120
     DPVCIGLRLM ERDGEVWGYG NPGLEYQPLC VSSNQEWTTF KAPLSAQHPG WFHFPHSGNV       180
     DLGNQTLDAD ILALVTLELG LKGDGHLISG QAVLDIRNMR VQPDSP                      226
//

If you have problems or comments...

PBIL Back to PBIL home page