(data stored in ACNUC27125 zone)

EMBL: CP000828.PE227

CP000828.PE227       Location/Qualifiers
FT   CDS             229498..230028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25318"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7Q8"
FT                   /protein_id="ABW25318.1"
FT                   /translation="MQKISLGLGVGDACLLVDLDPWKVQSLLDEGQAVFESRGLETTGV
FT                   ISITKSEIKTPTEGLYLDYQKARIALKEKALTSIVKSKNIFQCHKGKLMLELFFGGEFN
FT                   SSSIKESEIQTTISVVMAYVMEQLGPSHKKALKAVLTSNKDILDIPKSEYRAIKRIAKK
FT                   IRSDKQMTIDFAA"
     MQKISLGLGV GDACLLVDLD PWKVQSLLDE GQAVFESRGL ETTGVISITK SEIKTPTEGL        60
     YLDYQKARIA LKEKALTSIV KSKNIFQCHK GKLMLELFFG GEFNSSSIKE SEIQTTISVV       120
     MAYVMEQLGP SHKKALKAVL TSNKDILDIP KSEYRAIKRI AKKIRSDKQM TIDFAA           176
//

If you have problems or comments...

PBIL Back to PBIL home page