(data stored in ACNUC5340 zone)

EMBL: CP000828.PE231

CP000828.PE231       Location/Qualifiers
FT   CDS             complement(231763..232101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25322"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8T2"
FT                   /protein_id="ABW25322.1"
FT                   /translation="MTPQPITIKNGSKQGSYTFGALPIFFSVPNAGRFSNSHFFLSPIA
FT                   RSDKSGQYKIFEQWRLCQLRNPKFDYFGQNHFLDENDFVVLGTILDTQNQIDCIPKIQK
FT                   QIDYYFVF"
     MTPQPITIKN GSKQGSYTFG ALPIFFSVPN AGRFSNSHFF LSPIARSDKS GQYKIFEQWR        60
     LCQLRNPKFD YFGQNHFLDE NDFVVLGTIL DTQNQIDCIP KIQKQIDYYF VF               112
//

If you have problems or comments...

PBIL Back to PBIL home page