(data stored in ACNUC27125 zone)

EMBL: CP000828.PE232

CP000828.PE232       Location/Qualifiers
FT   CDS             complement(232200..232883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25323"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8T3"
FT                   /protein_id="ABW25323.1"
FT                   /translation="MGKNAKIKAAKRQKRTARRTKTKSVAKKRLAERRQGLKAAKHSKN
FT                   TRHYASMGPRDDSTLSDQVLDRLKNIKQGMPPSATDLAVLVETPFTCKILPAEWEYAAD
FT                   QAREAGGGETTMDPTEKKHLTKDWTNFFLDCRECVECHDEILADMKSQSSFSAEDQIAN
FT                   HIVLLGCRLKARRDQLEDLLQEYLGEDFSIFMETFNLSLGFLELHLQGLSIQLGVPYKK
FT                   LCGLN"
     MGKNAKIKAA KRQKRTARRT KTKSVAKKRL AERRQGLKAA KHSKNTRHYA SMGPRDDSTL        60
     SDQVLDRLKN IKQGMPPSAT DLAVLVETPF TCKILPAEWE YAADQAREAG GGETTMDPTE       120
     KKHLTKDWTN FFLDCRECVE CHDEILADMK SQSSFSAEDQ IANHIVLLGC RLKARRDQLE       180
     DLLQEYLGED FSIFMETFNL SLGFLELHLQ GLSIQLGVPY KKLCGLN                     227
//

If you have problems or comments...

PBIL Back to PBIL home page