(data stored in ACNUC27125 zone)

EMBL: CP000828.PE234

CP000828.PE234       Location/Qualifiers
FT   CDS             complement(234120..239459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25325"
FT                   /db_xref="GOA:B0C8T5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8T5"
FT                   /protein_id="ABW25325.1"
FT                   /translation="MTHAERLAFLDSPAEKTASLEFNGLKGSTNVSASGAKKEAKVNPY
FT                   LIVPELVEGLSSAENLALRRKNTVDVRNPQPNRPEVLDELGLIAWGKPYDQVTSDLVCT
FT                   SNPDFLGAKAANLFFNELVGEHGRFLAAVDKWSGYRGFLGSSGVEELVRINDDGTRRWL
FT                   KDGSRAVYPVKLLKFLARAEGKAVTWFPHGQIKDRKATSLPGTMPDFIGLEIDDGCLNE
FT                   QLARLVTLQQFLGTKFLMLWSGKKSIHFYIPTIDHPESRDQYYEVLKTAISVTGGDYAV
FT                   ASAGRALRMAGAFRAVRVGNENVITNQSIMQLGSRDLSFSELNDGLLSFFRQEYGKDYR
FT                   SGKDWKYYQSLGLQIVKAPKGNNTIDVTGRKVTDVFLQSDEENDALLGGKRAKGIKAKK
FT                   VKAKAPKTPVEAVATQNVEEHKNLRLAQEARIAAGITGHGLTTEEILEVVSDPINQGLT
FT                   YHQKGTELSDRHQRWSILLGIYHSDGGTAEERYELAENFGVDNFGLDEAYVAKELGSTC
FT                   YSIGLSSIIRNIHGQVDGTWKPSERVRTLVAKSKNAANALEATNISEGLASLGEGVVPL
FT                   LTSDASQLDTEIELDNVKLQAIQLDRLTSLTLKGISTKCIDSQLRPEYTEVLKDRTIAL
FT                   HADVEGLGNDAQGLTRLKFNLMRTWFALEGNGCKVLVRIDSQKHLYTSLNELTGHLSKL
FT                   INQRIYQHTLPKLQDRAGSGVFNARYMAAGLIDGVKLADKIIEIHQDESKSNLFALSGP
FT                   TGTGKTTLVEQLLELLECKKFYAAPLKILALENGAALATDRNDEQAAEYEGLGLGDISA
FT                   CLQGFFNFGRFEKFATDKVVVFIDETDRVILDLLGSTHATQRQANLNQLKRILDHAKEN
FT                   DWPVIIAQQNLSEIAVRFFEWWMDVEANVFVNQYKEQFKDGLTLTQESYLGAVSAHLTG
FT                   DHEAFGFGKDSRLQFTQPKSVRRLDIHCQSANDILKFQEFTRPQRYLKHIFRDAKAKQA
FT                   LKELGAEDWDKYAKAPLFEIKAIDFSPEALKLWRFLEALQQPFWVDEVTDQHVLVKSTS
FT                   KKDTAGNEVTQHLVYWDFSPVGKYDGWIGGEKNHQKLKVEQWLETQDKGWTKELFVTQQ
FT                   RYGAPWQELLGMGLSWESAKALIRLMHEAFLDSKELVFPLFAATRDCMRSGKKTKELQN
FT                   VIAEGTKDGQHLMRSPLIGTGLSFYGDALDISATLVLASWGSLEDISQALSRNRSRPET
FT                   IVYAPRVLNNRVALDITQEWKDNHANQSRKNRAELKLLGKTGNRFNLNDAIACFEAIHG
FT                   RMEGFTYRALELFAQGRACAFACAGGGTLVLADNWLERFHKDRAFFGEFFNDVFLEWLF
FT                   GSKFAEDYLDVLDNVVECEDRVYEFFVFCAIEQEQIARHVEVTGSQSAKNLQGWEIKEG
FT                   TSFVDALSSSKNTGQFLSLVNAQRMAQLKYETYHFAECFLDHYADYTENGITFIERENL
FT                   KEYNSQGRVVFDGGREPDEIRSRQGDVACILENLRTHQYLQVVEESHFIQSEAEARRIK
FT                   NSPTSTVAEQRAADLALLRLEYPESQWSDPDFIYYTLVHKNGQLRSCATRLARYLLNSD
FT                   LFTKDQCQKFKRDAANGDHLHGVLRGTLREQIFINDSGVADFYRTHGRGNNISEAEVRE
FT                   SQFWAYLVEHQQELWDLFQLQTANDSPIAVINRLVKRLSYDPMPCVARTGNGGSQRRYA
FT                   AIVNKDVHEIRKQLLRGTVLYVKKQIDDACAKDCVDARSLADPLFYNSNDSLDRNSGSY
FT                   PKWFLEFRRSIEDQIAELDKLIE"
     MTHAERLAFL DSPAEKTASL EFNGLKGSTN VSASGAKKEA KVNPYLIVPE LVEGLSSAEN        60
     LALRRKNTVD VRNPQPNRPE VLDELGLIAW GKPYDQVTSD LVCTSNPDFL GAKAANLFFN       120
     ELVGEHGRFL AAVDKWSGYR GFLGSSGVEE LVRINDDGTR RWLKDGSRAV YPVKLLKFLA       180
     RAEGKAVTWF PHGQIKDRKA TSLPGTMPDF IGLEIDDGCL NEQLARLVTL QQFLGTKFLM       240
     LWSGKKSIHF YIPTIDHPES RDQYYEVLKT AISVTGGDYA VASAGRALRM AGAFRAVRVG       300
     NENVITNQSI MQLGSRDLSF SELNDGLLSF FRQEYGKDYR SGKDWKYYQS LGLQIVKAPK       360
     GNNTIDVTGR KVTDVFLQSD EENDALLGGK RAKGIKAKKV KAKAPKTPVE AVATQNVEEH       420
     KNLRLAQEAR IAAGITGHGL TTEEILEVVS DPINQGLTYH QKGTELSDRH QRWSILLGIY       480
     HSDGGTAEER YELAENFGVD NFGLDEAYVA KELGSTCYSI GLSSIIRNIH GQVDGTWKPS       540
     ERVRTLVAKS KNAANALEAT NISEGLASLG EGVVPLLTSD ASQLDTEIEL DNVKLQAIQL       600
     DRLTSLTLKG ISTKCIDSQL RPEYTEVLKD RTIALHADVE GLGNDAQGLT RLKFNLMRTW       660
     FALEGNGCKV LVRIDSQKHL YTSLNELTGH LSKLINQRIY QHTLPKLQDR AGSGVFNARY       720
     MAAGLIDGVK LADKIIEIHQ DESKSNLFAL SGPTGTGKTT LVEQLLELLE CKKFYAAPLK       780
     ILALENGAAL ATDRNDEQAA EYEGLGLGDI SACLQGFFNF GRFEKFATDK VVVFIDETDR       840
     VILDLLGSTH ATQRQANLNQ LKRILDHAKE NDWPVIIAQQ NLSEIAVRFF EWWMDVEANV       900
     FVNQYKEQFK DGLTLTQESY LGAVSAHLTG DHEAFGFGKD SRLQFTQPKS VRRLDIHCQS       960
     ANDILKFQEF TRPQRYLKHI FRDAKAKQAL KELGAEDWDK YAKAPLFEIK AIDFSPEALK      1020
     LWRFLEALQQ PFWVDEVTDQ HVLVKSTSKK DTAGNEVTQH LVYWDFSPVG KYDGWIGGEK      1080
     NHQKLKVEQW LETQDKGWTK ELFVTQQRYG APWQELLGMG LSWESAKALI RLMHEAFLDS      1140
     KELVFPLFAA TRDCMRSGKK TKELQNVIAE GTKDGQHLMR SPLIGTGLSF YGDALDISAT      1200
     LVLASWGSLE DISQALSRNR SRPETIVYAP RVLNNRVALD ITQEWKDNHA NQSRKNRAEL      1260
     KLLGKTGNRF NLNDAIACFE AIHGRMEGFT YRALELFAQG RACAFACAGG GTLVLADNWL      1320
     ERFHKDRAFF GEFFNDVFLE WLFGSKFAED YLDVLDNVVE CEDRVYEFFV FCAIEQEQIA      1380
     RHVEVTGSQS AKNLQGWEIK EGTSFVDALS SSKNTGQFLS LVNAQRMAQL KYETYHFAEC      1440
     FLDHYADYTE NGITFIEREN LKEYNSQGRV VFDGGREPDE IRSRQGDVAC ILENLRTHQY      1500
     LQVVEESHFI QSEAEARRIK NSPTSTVAEQ RAADLALLRL EYPESQWSDP DFIYYTLVHK      1560
     NGQLRSCATR LARYLLNSDL FTKDQCQKFK RDAANGDHLH GVLRGTLREQ IFINDSGVAD      1620
     FYRTHGRGNN ISEAEVRESQ FWAYLVEHQQ ELWDLFQLQT ANDSPIAVIN RLVKRLSYDP      1680
     MPCVARTGNG GSQRRYAAIV NKDVHEIRKQ LLRGTVLYVK KQIDDACAKD CVDARSLADP      1740
     LFYNSNDSLD RNSGSYPKWF LEFRRSIEDQ IAELDKLIE                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page