(data stored in ACNUC27125 zone)

EMBL: CP000828.PE235

CP000828.PE235       Location/Qualifiers
FT   CDS             239500..239658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25326"
FT                   /db_xref="GOA:B0C8T6"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8T6"
FT                   /protein_id="ABW25326.1"
FT                   /translation="MARNVTESLQFSTFFSVSFEIFFESLEALPSVALGLTPLASGSLV
FT                   LAFVVVD"
     MARNVTESLQ FSTFFSVSFE IFFESLEALP SVALGLTPLA SGSLVLAFVV VD                52
//

If you have problems or comments...

PBIL Back to PBIL home page