(data stored in ACNUC27125 zone)

EMBL: CP000828.PE24

CP000828.PE24        Location/Qualifiers
FT   CDS             29423..30424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0028"
FT                   /product="kinase, pfkB family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25115"
FT                   /db_xref="GOA:B0C503"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0C503"
FT                   /protein_id="ABW25115.1"
FT                   /translation="MAKYDVYGLGNALVDIECEVSVEVLQNLGVDKGVMTLLEEADQQR
FT                   IIDHLSSYSLKRGCGGSAANTLIAVSQFGGKSCYSCKVANDEPGQFYLDDLICCGVDTN
FT                   LQQHQPEAGVTGKCLVFVTPDADRTMNTFLGISGRFSEAELLPDAIANSTYTYIEGYLV
FT                   TSPDAKAAAIKARDMAKAAGQKVSLTLSDFNMVSFFKDGLLEMIGSGLDLIFANESEAL
FT                   KMAETEDISAAIDHMKTLATCFAITRGPQGSLIYDGQQVLEIAPTPVKAIDTVGAGDMY
FT                   AGAVLYGITNGMSYSEAGQLGSVAAAKLVASLGPRMPTEVTRSLLTEVKTAS"
     MAKYDVYGLG NALVDIECEV SVEVLQNLGV DKGVMTLLEE ADQQRIIDHL SSYSLKRGCG        60
     GSAANTLIAV SQFGGKSCYS CKVANDEPGQ FYLDDLICCG VDTNLQQHQP EAGVTGKCLV       120
     FVTPDADRTM NTFLGISGRF SEAELLPDAI ANSTYTYIEG YLVTSPDAKA AAIKARDMAK       180
     AAGQKVSLTL SDFNMVSFFK DGLLEMIGSG LDLIFANESE ALKMAETEDI SAAIDHMKTL       240
     ATCFAITRGP QGSLIYDGQQ VLEIAPTPVK AIDTVGAGDM YAGAVLYGIT NGMSYSEAGQ       300
     LGSVAAAKLV ASLGPRMPTE VTRSLLTEVK TAS                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page