(data stored in ACNUC5340 zone)

EMBL: CP000828.PE240

CP000828.PE240       Location/Qualifiers
FT   CDS             complement(241892..243091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0245"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25331"
FT                   /db_xref="GOA:B0C8U1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8U1"
FT                   /protein_id="ABW25331.1"
FT                   /translation="MATNRLTDLQVRNAKPKTGSYRLSDGGGLFLQITPAGGKHWKYRY
FT                   RIQGKESTFSIGSYPELGLGEARAKHLEARRLVAQGLNPTTEAKRLQLSLQLAQGNTFE
FT                   FVADEWFSQKNAGWSESYRGIVRNRLNRDLNPSLGPRPVTEITAPEVLAVIRAVEARGA
FT                   NALAHKCLSIVRMVLGYAVATGRCDRNVVNDLGGALAPVDAKHRAAITDPKRVGELMRM
FT                   IADYRGSMVVRAAMRMGALTFVRPGELRTMQWSQINWNTKEWRFQVSKTETDHIVPLAT
FT                   QAIEILQTLQLITGNGTSRYVFPSANSMTRHMSNNAVLAALRAMGITKDEMSGHGFRAM
FT                   ARTLIAEELHYRPELIEHQLAHAVRGPLGRAYNRTEFLEERREMMQAWADYLDELERDC
FT                   "
     MATNRLTDLQ VRNAKPKTGS YRLSDGGGLF LQITPAGGKH WKYRYRIQGK ESTFSIGSYP        60
     ELGLGEARAK HLEARRLVAQ GLNPTTEAKR LQLSLQLAQG NTFEFVADEW FSQKNAGWSE       120
     SYRGIVRNRL NRDLNPSLGP RPVTEITAPE VLAVIRAVEA RGANALAHKC LSIVRMVLGY       180
     AVATGRCDRN VVNDLGGALA PVDAKHRAAI TDPKRVGELM RMIADYRGSM VVRAAMRMGA       240
     LTFVRPGELR TMQWSQINWN TKEWRFQVSK TETDHIVPLA TQAIEILQTL QLITGNGTSR       300
     YVFPSANSMT RHMSNNAVLA ALRAMGITKD EMSGHGFRAM ARTLIAEELH YRPELIEHQL       360
     AHAVRGPLGR AYNRTEFLEE RREMMQAWAD YLDELERDC                              399
//

If you have problems or comments...

PBIL Back to PBIL home page