(data stored in ACNUC5340 zone)

EMBL: CP000828.PE243

CP000828.PE243       Location/Qualifiers
FT   CDS             244145..244789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0248"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25334"
FT                   /db_xref="InterPro:IPR010802"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8U4"
FT                   /protein_id="ABW25334.1"
FT                   /translation="MGLGAICTLSCLGLHTETALGATKIKFTYGPFGQSLTVQELKTFA
FT                   ETGKASSKLKFFMNAADQDPKVVRRFLTQDVKISLRLADRLLYLLPGEYALFQAGQIFQ
FT                   TPSQGANIQALRSGVIQSLSDDSQISLLEFLEKYPLAEMTIDGVKLARTADQIDRLVSR
FT                   FAPSVESGAAIATELLESLVCDCESGAIQPKPSVTAPNPIPEPAPDATPPG"
     MGLGAICTLS CLGLHTETAL GATKIKFTYG PFGQSLTVQE LKTFAETGKA SSKLKFFMNA        60
     ADQDPKVVRR FLTQDVKISL RLADRLLYLL PGEYALFQAG QIFQTPSQGA NIQALRSGVI       120
     QSLSDDSQIS LLEFLEKYPL AEMTIDGVKL ARTADQIDRL VSRFAPSVES GAAIATELLE       180
     SLVCDCESGA IQPKPSVTAP NPIPEPAPDA TPPG                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page