(data stored in ACNUC27125 zone)

EMBL: CP000828.PE246

CP000828.PE246       Location/Qualifiers
FT   CDS             complement(247652..248512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25337"
FT                   /db_xref="GOA:B0C8U7"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8U7"
FT                   /protein_id="ABW25337.1"
FT                   /translation="MYLPEDYQSLRKWQVICSHCYSLYQAEPGVVIGSWLGFSRNHQNI
FT                   YLARIQMRTGSIKTVEIDQLIGANIPIILMMPAKGVGHLQPILLVDVKTNQSHFLPHPQ
FT                   RQFLKYQRYTVIGVSIFILCLGLSIRGGVATIIIVAVVGSLLVGNILPRILRSKQHNSK
FT                   TQNRLMLEQRLIKQSDAWGEQLQQLEIELTKLHQANKRLLPYSQDEAFHIRSISDKPRK
FT                   RQYFQSKYYRLSELVECYVLTKNLIDINIPIIQLAEEVPVDLISQLSNLSLQIKDLERR
FT                   YQSMT"
     MYLPEDYQSL RKWQVICSHC YSLYQAEPGV VIGSWLGFSR NHQNIYLARI QMRTGSIKTV        60
     EIDQLIGANI PIILMMPAKG VGHLQPILLV DVKTNQSHFL PHPQRQFLKY QRYTVIGVSI       120
     FILCLGLSIR GGVATIIIVA VVGSLLVGNI LPRILRSKQH NSKTQNRLML EQRLIKQSDA       180
     WGEQLQQLEI ELTKLHQANK RLLPYSQDEA FHIRSISDKP RKRQYFQSKY YRLSELVECY       240
     VLTKNLIDIN IPIIQLAEEV PVDLISQLSN LSLQIKDLER RYQSMT                      286
//

If you have problems or comments...

PBIL Back to PBIL home page