(data stored in ACNUC27125 zone)

EMBL: CP000828.PE249

CP000828.PE249       Location/Qualifiers
FT   CDS             250366..251289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0254"
FT                   /product="DUF6 domain transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25340"
FT                   /db_xref="GOA:B0C8V0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V0"
FT                   /protein_id="ABW25340.1"
FT                   /translation="MTQLKSTGKKVGSYGVKPNPYAFIALLLGAIGIAFAPIFVRLSEL
FT                   GPSATAFYRLGFAVPLLGVWLWTSRPATSFPVNEQRVTGLPLISAGCFFAADLAVWHWS
FT                   IQFTSVANATLLANFAPIFVVLGGWLLFGETVSRWFLVAIALVLLGATLLVSASIDTQH
FT                   VFGDALGLLTAIFYAGYILSVARLRLHFPTATIAFACSIVGATILFFIAWLSGEGFLPM
FT                   TMTGWLSLVGLACISQVIGQSLIMFALAHLPSAFASVSLLLQPVTAAILAWRLFGEALT
FT                   LQQGFGGVIVLAGIVLARWSDRKPVS"
     MTQLKSTGKK VGSYGVKPNP YAFIALLLGA IGIAFAPIFV RLSELGPSAT AFYRLGFAVP        60
     LLGVWLWTSR PATSFPVNEQ RVTGLPLISA GCFFAADLAV WHWSIQFTSV ANATLLANFA       120
     PIFVVLGGWL LFGETVSRWF LVAIALVLLG ATLLVSASID TQHVFGDALG LLTAIFYAGY       180
     ILSVARLRLH FPTATIAFAC SIVGATILFF IAWLSGEGFL PMTMTGWLSL VGLACISQVI       240
     GQSLIMFALA HLPSAFASVS LLLQPVTAAI LAWRLFGEAL TLQQGFGGVI VLAGIVLARW       300
     SDRKPVS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page