(data stored in ACNUC27125 zone)

EMBL: CP000828.PE25

CP000828.PE25        Location/Qualifiers
FT   CDS             complement(30398..30874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25116"
FT                   /db_xref="GOA:B0C504"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B0C504"
FT                   /protein_id="ABW25116.1"
FT                   /translation="MCLNSLLAIVLSLIVVLERAQARLWHGARPEDTAHQRDYLDKPNQ
FT                   WAVWVEKLTKGWFLTSNPDQGRLQRKVRAFGNFVEYTPLVILFLVVLELMQAPSPLLWG
FT                   LGIAYSVGRMAHAVGVMETYGPSPGRAIGYFLTLLVYLIGASACLVLGSRFYFS"
     MCLNSLLAIV LSLIVVLERA QARLWHGARP EDTAHQRDYL DKPNQWAVWV EKLTKGWFLT        60
     SNPDQGRLQR KVRAFGNFVE YTPLVILFLV VLELMQAPSP LLWGLGIAYS VGRMAHAVGV       120
     METYGPSPGR AIGYFLTLLV YLIGASACLV LGSRFYFS                               158
//

If you have problems or comments...

PBIL Back to PBIL home page