(data stored in ACNUC8465 zone)

EMBL: CP000828.PE252

CP000828.PE252       Location/Qualifiers
FT   CDS             complement(252893..255286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0257"
FT                   /product="TPR domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25343"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V3"
FT                   /protein_id="ABW25343.1"
FT                   /translation="MANVTLLDLNKRSIELLNPKFELNKRNHKANYLRMSFQVSPDKYK
FT                   QIKSTELFNLYDEILVDTDLQFLDYSIDVYLELFLRPDLVEEFSGLLSLSDPGSSGLRC
FT                   LEQLSPEHALLKTDSWLLTSIRQTQANREVYSKTIWAYLCVHEEQDPLEQDLWSILSPF
FT                   LQRVTESSLTNMLGQQNSFITTQAYQRWKSSVQNMDEVKQENVQVLLKKLCEELGTISP
FT                   EYHQQEFSQSSVDQLSNGLDLPKGLNSGSSFSTSHPSNLGHLPIEEKRLSQSTIWDLQR
FT                   QYYLQQGNTIFLQECEQQSSRQARSKASHYAQLIFSCLRDYCAINRRHKANYQAIDASQ
FT                   KIYLIELGAGSGHFAYQVLHHLLPLLSQPTLKKISVCYVLTDFVTANIEFWKQHPSLQP
FT                   FFKEGTLDIAYFDIEYPTDLTLQISGDSLTPDTLNNPIILIANQVLSKLPQDAFCTESG
FT                   KLSESRVRLFAPAGHQLRDWRALGQIALQFSDVGLDKSDYYEDAIANNILYTYSETNHP
FT                   THFLFPTVALSCLDYFRHLSKDRLMIISSDFGYCHQNAWQGYGEPVFKLQGSVSLPVNY
FT                   HVLAAYTVQQGGLVLQPHRHTPDFYTQALLFGKHPTQYQETQLCYQFYSTVTETDSWQG
FT                   SVQITTERMETLSLSQLIGYLHSHHWDSQIFLDCFSSLLDQLDTATPAIRLDLIEGIHQ
FT                   IWTNYYPIGENQDLAFYLGMVLYQLAEYADAIDYFEKSIQLTGTDPATLYNISMCHFHL
FT                   QQLEETTTYLQKALQADPSFEEALIFQRKLTQQQSHLDSGQTHH"
     MANVTLLDLN KRSIELLNPK FELNKRNHKA NYLRMSFQVS PDKYKQIKST ELFNLYDEIL        60
     VDTDLQFLDY SIDVYLELFL RPDLVEEFSG LLSLSDPGSS GLRCLEQLSP EHALLKTDSW       120
     LLTSIRQTQA NREVYSKTIW AYLCVHEEQD PLEQDLWSIL SPFLQRVTES SLTNMLGQQN       180
     SFITTQAYQR WKSSVQNMDE VKQENVQVLL KKLCEELGTI SPEYHQQEFS QSSVDQLSNG       240
     LDLPKGLNSG SSFSTSHPSN LGHLPIEEKR LSQSTIWDLQ RQYYLQQGNT IFLQECEQQS       300
     SRQARSKASH YAQLIFSCLR DYCAINRRHK ANYQAIDASQ KIYLIELGAG SGHFAYQVLH       360
     HLLPLLSQPT LKKISVCYVL TDFVTANIEF WKQHPSLQPF FKEGTLDIAY FDIEYPTDLT       420
     LQISGDSLTP DTLNNPIILI ANQVLSKLPQ DAFCTESGKL SESRVRLFAP AGHQLRDWRA       480
     LGQIALQFSD VGLDKSDYYE DAIANNILYT YSETNHPTHF LFPTVALSCL DYFRHLSKDR       540
     LMIISSDFGY CHQNAWQGYG EPVFKLQGSV SLPVNYHVLA AYTVQQGGLV LQPHRHTPDF       600
     YTQALLFGKH PTQYQETQLC YQFYSTVTET DSWQGSVQIT TERMETLSLS QLIGYLHSHH       660
     WDSQIFLDCF SSLLDQLDTA TPAIRLDLIE GIHQIWTNYY PIGENQDLAF YLGMVLYQLA       720
     EYADAIDYFE KSIQLTGTDP ATLYNISMCH FHLQQLEETT TYLQKALQAD PSFEEALIFQ       780
     RKLTQQQSHL DSGQTHH                                                      797
//

If you have problems or comments...

PBIL Back to PBIL home page