(data stored in ACNUC27125 zone)

EMBL: CP000828.PE254

CP000828.PE254       Location/Qualifiers
FT   CDS             complement(257480..259111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25345"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V5"
FT                   /protein_id="ABW25345.1"
FT                   /translation="MRTYCHRQKKKTRHLAQPTKIDKPSQSLEQPPTLQERSNEAGLAE
FT                   WAAQQQKWAKIGNTLLDQPPGNSPQPWLQPQRDKNTTSPSEPSANLHISPMMGANPPIQ
FT                   RLMDVKSFQEATKGTLFHPRKRITAIDDPLKKIDQSGMDSILLNELLEAINGWLKVASE
FT                   DSTRKPVVLQLREEVMTELEKIATSLSQDFDPENPPPTRSRRNAFSAEVTGAGKKYGSD
FT                   FSDFDSKQFRVSGRAPQRRIEEVKRLKMEDGTVVYYATGLVTNFKGKAPMVAPYPDPIP
FT                   LGDWYPKVTHINGMAVAPKSGLLSAAALQETVNTALGGKEDVAFGQDAVDILYTYSAQR
FT                   GNVVFDLIDCIKGKLQIEDEATGKQEDIMLDAVRSKKRVTVSAHSRGTIKTDNAVRNVH
FT                   EILTKELLPSIRAARQEEVMAYWQANDPQIGLSADMLAELSYSGFAAEEAKKQLNTYIQ
FT                   LIYAGNAVQHPSAFIDVKLFVGGLDLVSMFVGTYSETGRKIDSIIGTGGSKKSKLKSVG
FT                   GTKGHGFVGNYVPTVGQEIAQDLQQR"
     MRTYCHRQKK KTRHLAQPTK IDKPSQSLEQ PPTLQERSNE AGLAEWAAQQ QKWAKIGNTL        60
     LDQPPGNSPQ PWLQPQRDKN TTSPSEPSAN LHISPMMGAN PPIQRLMDVK SFQEATKGTL       120
     FHPRKRITAI DDPLKKIDQS GMDSILLNEL LEAINGWLKV ASEDSTRKPV VLQLREEVMT       180
     ELEKIATSLS QDFDPENPPP TRSRRNAFSA EVTGAGKKYG SDFSDFDSKQ FRVSGRAPQR       240
     RIEEVKRLKM EDGTVVYYAT GLVTNFKGKA PMVAPYPDPI PLGDWYPKVT HINGMAVAPK       300
     SGLLSAAALQ ETVNTALGGK EDVAFGQDAV DILYTYSAQR GNVVFDLIDC IKGKLQIEDE       360
     ATGKQEDIML DAVRSKKRVT VSAHSRGTIK TDNAVRNVHE ILTKELLPSI RAARQEEVMA       420
     YWQANDPQIG LSADMLAELS YSGFAAEEAK KQLNTYIQLI YAGNAVQHPS AFIDVKLFVG       480
     GLDLVSMFVG TYSETGRKID SIIGTGGSKK SKLKSVGGTK GHGFVGNYVP TVGQEIAQDL       540
     QQR                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page