(data stored in ACNUC27125 zone)

EMBL: CP000828.PE256

CP000828.PE256       Location/Qualifiers
FT   CDS             complement(259625..260017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25347"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ3"
FT                   /protein_id="ABW25347.1"
FT                   /translation="MFYFLMQCPLCGHPKTHKHGKTSKGSQRYRCPHCQQTFSETFDTL
FT                   CYRRQISPETIQTILQAHVEGSSLRGLSRITGVAYNTCVSVVRSASHKSQMIHNGEVQA
FT                   VATDVINADELWSFVKKSKSTVSRRS"
     MFYFLMQCPL CGHPKTHKHG KTSKGSQRYR CPHCQQTFSE TFDTLCYRRQ ISPETIQTIL        60
     QAHVEGSSLR GLSRITGVAY NTCVSVVRSA SHKSQMIHNG EVQAVATDVI NADELWSFVK       120
     KSKSTVSRRS                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page