(data stored in ACNUC5340 zone)

EMBL: CP000828.PE257

CP000828.PE257       Location/Qualifiers
FT   CDS             complement(260350..262431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25348"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8V8"
FT                   /protein_id="ABW25348.1"
FT                   /translation="MLLLASLSGLSVAKSSSEEVLMMRTQTSRSKKPTSQKLPQAKEVT
FT                   QPPLVEVPLMQASDEEGLAAWEKQRQKWERFGTPWMDKVPNLSGEINQPWIQPKLTIGQ
FT                   PNDKYEKEADRVAKQVVTNTNYPDFVNVPQGRSGQHQGWVIDNLQAKPEVFAKQQGPKS
FT                   IGGTLPVNLESAINQARGSGRQLDVSLQQSMGQVMNADFSRVRVHTDVQSDRLSQSIQA
FT                   KAFTTGQDVFFRKGEYQPHSKYGQELIAHELTHVVQQQGQSVSSSNIQRAIDWQVQDYF
FT                   FKIGPEPKLGIVKDPNSLYQYLNEWINRIEPWVKSIIENKIDANYYQSLKLEDKNDFDR
FT                   LKYEKNTWDEIVKGWNKIKPGKIKEYISFLADKSSESLLSKVVIGRLKESTGQSTAGQR
FT                   YTYRFYYLEDAFRAILAEDYRKESTKKEDKLADEVLSSDIEKQIEFWIVGFINNFTKDA
FT                   RYLKVKEFMIDAEYKDYFGGKISDVLDNPENKSISELISALHDATTILFEMSEVIYQID
FT                   NPQYKPRDKYLVQHGEKINFYKLIDKGGISKEVANYVAVPPDKDKANYYINLNNNSNNN
FT                   NSNYQNQEDIKYVRPGYLNESKSEVLKQLRKNKMLVEIGPSYTTGRLMQLSDTFGAGPK
FT                   TKLAIALAIFAFWNKGYDKAVSGIHRFHFVMDMCKNYVPQLKYENEYPNSIAEIWNSL"
     MLLLASLSGL SVAKSSSEEV LMMRTQTSRS KKPTSQKLPQ AKEVTQPPLV EVPLMQASDE        60
     EGLAAWEKQR QKWERFGTPW MDKVPNLSGE INQPWIQPKL TIGQPNDKYE KEADRVAKQV       120
     VTNTNYPDFV NVPQGRSGQH QGWVIDNLQA KPEVFAKQQG PKSIGGTLPV NLESAINQAR       180
     GSGRQLDVSL QQSMGQVMNA DFSRVRVHTD VQSDRLSQSI QAKAFTTGQD VFFRKGEYQP       240
     HSKYGQELIA HELTHVVQQQ GQSVSSSNIQ RAIDWQVQDY FFKIGPEPKL GIVKDPNSLY       300
     QYLNEWINRI EPWVKSIIEN KIDANYYQSL KLEDKNDFDR LKYEKNTWDE IVKGWNKIKP       360
     GKIKEYISFL ADKSSESLLS KVVIGRLKES TGQSTAGQRY TYRFYYLEDA FRAILAEDYR       420
     KESTKKEDKL ADEVLSSDIE KQIEFWIVGF INNFTKDARY LKVKEFMIDA EYKDYFGGKI       480
     SDVLDNPENK SISELISALH DATTILFEMS EVIYQIDNPQ YKPRDKYLVQ HGEKINFYKL       540
     IDKGGISKEV ANYVAVPPDK DKANYYINLN NNSNNNNSNY QNQEDIKYVR PGYLNESKSE       600
     VLKQLRKNKM LVEIGPSYTT GRLMQLSDTF GAGPKTKLAI ALAIFAFWNK GYDKAVSGIH       660
     RFHFVMDMCK NYVPQLKYEN EYPNSIAEIW NSL                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page