(data stored in ACNUC27125 zone)

EMBL: CP000828.PE261

CP000828.PE261       Location/Qualifiers
FT   CDS             complement(265105..266415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25352"
FT                   /db_xref="InterPro:IPR025351"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8W2"
FT                   /protein_id="ABW25352.1"
FT                   /translation="MSNFLAIATVTAVLQRTLQAAIQEDVEGARVTTLRPADIGKGTPV
FT                   SGVNIYLYQTALNTAWNNTDHRGRHRHSDTAKRSRTALDLHYMISVYGNEVELEPQRLL
FT                   GSVVRSLSDAQVVREEMIQETLSDSNYEYLAESDLWQQVEEINFKPMDMSLEDLSKVWS
FT                   VFFQTPYALSMAYRSTVIMIEGQTPAQKALPVASRGLAVAPFSGQPLITEIASMTGKFE
FT                   PIVADSTLLIRGKRLQGNHTGIRIGAVEVTPSQVSEGELLLPLVRLPTHSLRAGVQSLQ
FT                   VVHQSQTPTPNRPGAWRSARAALVAPNHQVGMVSNASPFLLRPTIIDLAVTITQGQEEE
FT                   LRSAAIQITTDVTIASLQQVTLILNERTVEHPAAYLFEASHRTTDNQSITVEVDDVKPG
FT                   EYFVRIQIDGAESSLNIDPEVTSPTFGSFVGPTVQII"
     MSNFLAIATV TAVLQRTLQA AIQEDVEGAR VTTLRPADIG KGTPVSGVNI YLYQTALNTA        60
     WNNTDHRGRH RHSDTAKRSR TALDLHYMIS VYGNEVELEP QRLLGSVVRS LSDAQVVREE       120
     MIQETLSDSN YEYLAESDLW QQVEEINFKP MDMSLEDLSK VWSVFFQTPY ALSMAYRSTV       180
     IMIEGQTPAQ KALPVASRGL AVAPFSGQPL ITEIASMTGK FEPIVADSTL LIRGKRLQGN       240
     HTGIRIGAVE VTPSQVSEGE LLLPLVRLPT HSLRAGVQSL QVVHQSQTPT PNRPGAWRSA       300
     RAALVAPNHQ VGMVSNASPF LLRPTIIDLA VTITQGQEEE LRSAAIQITT DVTIASLQQV       360
     TLILNERTVE HPAAYLFEAS HRTTDNQSIT VEVDDVKPGE YFVRIQIDGA ESSLNIDPEV       420
     TSPTFGSFVG PTVQII                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page