(data stored in ACNUC27125 zone)

EMBL: CP000828.PE263

CP000828.PE263       Location/Qualifiers
FT   CDS             complement(267124..268284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25354"
FT                   /db_xref="GOA:B0C8W4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8W4"
FT                   /protein_id="ABW25354.1"
FT                   /translation="MQVDQPITLSNGSFGLEKLPDRRQSFSTIDLNQHCQDFLDLIIDY
FT                   LSLPIAWILRRGLGHQLKIGMEVDGCVPQDILTAAHNRTSLKDLLASPNLFSQFALVST
FT                   QPGLQHWVYQDWQVYSSCLCQHQGQYLLFVSQSPLTTSERQWIERQILLMSDYFDLHLA
FT                   FNQQRAALLAKQQHLHQTTHQLGTPLSLITLYADMLQVKTTPQNGQNYLVPLQQAVKQL
FT                   HHHLQDLVDDEEEDSPLVEPCNLHDLVAENIRALQPHLQSQGMEICYPQTSEVVWIDRW
FT                   QMLQVFDNLLSNALHFSPQGGQITLTWQRFQTEILIEVRDQGPGLSSEDLCCMFSPYYS
FT                   RRQGGRGLGLAIAQQIVCRHRGRLWASNLPEGGAQFSISLPQESNN"
     MQVDQPITLS NGSFGLEKLP DRRQSFSTID LNQHCQDFLD LIIDYLSLPI AWILRRGLGH        60
     QLKIGMEVDG CVPQDILTAA HNRTSLKDLL ASPNLFSQFA LVSTQPGLQH WVYQDWQVYS       120
     SCLCQHQGQY LLFVSQSPLT TSERQWIERQ ILLMSDYFDL HLAFNQQRAA LLAKQQHLHQ       180
     TTHQLGTPLS LITLYADMLQ VKTTPQNGQN YLVPLQQAVK QLHHHLQDLV DDEEEDSPLV       240
     EPCNLHDLVA ENIRALQPHL QSQGMEICYP QTSEVVWIDR WQMLQVFDNL LSNALHFSPQ       300
     GGQITLTWQR FQTEILIEVR DQGPGLSSED LCCMFSPYYS RRQGGRGLGL AIAQQIVCRH       360
     RGRLWASNLP EGGAQFSISL PQESNN                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page