(data stored in ACNUC8465 zone)

EMBL: CP000828.PE268

CP000828.PE268       Location/Qualifiers
FT   CDS             272031..272513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25359"
FT                   /db_xref="GOA:B0C8W9"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8W9"
FT                   /protein_id="ABW25359.1"
FT                   /translation="MVQYLANSKFYFEIDGVTSLTLKSISGPEIELEVAGGDSAIGVTK
FT                   DAKTQTQATIGGVKYNSTIALTYVAGNEGEQKKLSDWYDDCHPDTFSGGGSKAMEGRKT
FT                   GSLVIYNPDGKEAMRFNFTDLFPGAKKQVGSLSVDSGGQLAEDNIDLYFTQVIRKV"
     MVQYLANSKF YFEIDGVTSL TLKSISGPEI ELEVAGGDSA IGVTKDAKTQ TQATIGGVKY        60
     NSTIALTYVA GNEGEQKKLS DWYDDCHPDT FSGGGSKAME GRKTGSLVIY NPDGKEAMRF       120
     NFTDLFPGAK KQVGSLSVDS GGQLAEDNID LYFTQVIRKV                             160
//

If you have problems or comments...

PBIL Back to PBIL home page