(data stored in ACNUC8465 zone)

EMBL: CP000828.PE269

CP000828.PE269       Location/Qualifiers
FT   CDS             272639..273043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25360"
FT                   /db_xref="GOA:B0C8X0"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8X0"
FT                   /protein_id="ABW25360.1"
FT                   /translation="MECSGFQSSQEVIEVVEVTPQLWGKQGKTKGRNIRTKIPGNATYS
FT                   NLTLKRGLMSSMTLWNWLQKVQEGDWAEQRREGALVIYNQAAKEQCRLEFQGAWPVSYK
FT                   ISDLDVKSGEHNIEEVEITVESVKRVEVTA"
     MECSGFQSSQ EVIEVVEVTP QLWGKQGKTK GRNIRTKIPG NATYSNLTLK RGLMSSMTLW        60
     NWLQKVQEGD WAEQRREGAL VIYNQAAKEQ CRLEFQGAWP VSYKISDLDV KSGEHNIEEV       120
     EITVESVKRV EVTA                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page