(data stored in ACNUC27125 zone)

EMBL: CP000828.PE27

CP000828.PE27        Location/Qualifiers
FT   CDS             31872..33323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0030"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25118"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B0C506"
FT                   /protein_id="ABW25118.1"
FT                   /translation="MKRLLGWGSIPWLALAIGSFQTPAQALDSVQFLLNEGFCQACTLS
FT                   NSDLSGLELANVKLNHAILIKADLSGANLSGADLTGANLSGANLSGADLTNANLTNANL
FT                   DQVNLTGARLNNTNLAGANVQIAVNTPVPSTAQSSFVSYYNPPEESTDISPISPIPSAP
FT                   PPTYGRVLNPPKSGYQSPTAVATRAPSIPAPSAPPIPTESPTVADNSIGGADDPSQAAA
FT                   LTTDGIGIIDGGTVPKGRVLVSLKGGPQGIQSTVRYGILGDLEALGYLDYSFGTVDESE
FT                   QGFGLKYRFLDQAKGKPLTISAAVNVGLTGETFINYATNNRNEFRQRGLNKAVPTIFQG
FT                   TDGNVGNNLIYSVSLPVHYQATDRLNLWVTPTFSYVQDRDIAVGGFNFGGSYEIVNNLN
FT                   FIAEVGASFAGRGNAFLNNTLGDAIPWNVGFRYDSSTLFGFTPGSKQLIFDLYATNRVG
FT                   TSPWNQLRVRDQDEPTIGVGVHLLW"
     MKRLLGWGSI PWLALAIGSF QTPAQALDSV QFLLNEGFCQ ACTLSNSDLS GLELANVKLN        60
     HAILIKADLS GANLSGADLT GANLSGANLS GADLTNANLT NANLDQVNLT GARLNNTNLA       120
     GANVQIAVNT PVPSTAQSSF VSYYNPPEES TDISPISPIP SAPPPTYGRV LNPPKSGYQS       180
     PTAVATRAPS IPAPSAPPIP TESPTVADNS IGGADDPSQA AALTTDGIGI IDGGTVPKGR       240
     VLVSLKGGPQ GIQSTVRYGI LGDLEALGYL DYSFGTVDES EQGFGLKYRF LDQAKGKPLT       300
     ISAAVNVGLT GETFINYATN NRNEFRQRGL NKAVPTIFQG TDGNVGNNLI YSVSLPVHYQ       360
     ATDRLNLWVT PTFSYVQDRD IAVGGFNFGG SYEIVNNLNF IAEVGASFAG RGNAFLNNTL       420
     GDAIPWNVGF RYDSSTLFGF TPGSKQLIFD LYATNRVGTS PWNQLRVRDQ DEPTIGVGVH       480
     LLW                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page