(data stored in ACNUC5340 zone)

EMBL: CP000828.PE270

CP000828.PE270       Location/Qualifiers
FT   CDS             273045..273464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25361"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8X1"
FT                   /protein_id="ABW25361.1"
FT                   /translation="MQLSNNLGLAPPPEAPQPITEPQTILGSVQTEFEFELPKGYLDTA
FT                   GNLHRKGIMRLSRAMDEIVPMRDPRVKANPAYATVIILSRVITRLGALDSISPNIIEGL
FT                   FACDLSYLQKFYRLINELEDGAEAEAPSSPEPQGS"
     MQLSNNLGLA PPPEAPQPIT EPQTILGSVQ TEFEFELPKG YLDTAGNLHR KGIMRLSRAM        60
     DEIVPMRDPR VKANPAYATV IILSRVITRL GALDSISPNI IEGLFACDLS YLQKFYRLIN       120
     ELEDGAEAEA PSSPEPQGS                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page