(data stored in ACNUC5340 zone)

EMBL: CP000828.PE271

CP000828.PE271       Location/Qualifiers
FT   CDS             273506..273817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25362"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8X2"
FT                   /protein_id="ABW25362.1"
FT                   /translation="MFTLPKGLLDDQGTLHRQGGLRLATGHDEIKSQRDPRVQDNPHYG
FT                   ALVLLTQAITFLGHFQTVTPLHLEQLFLTDFLYLQEVYVDLTHSYGGPIELGEHWATP"
     MFTLPKGLLD DQGTLHRQGG LRLATGHDEI KSQRDPRVQD NPHYGALVLL TQAITFLGHF        60
     QTVTPLHLEQ LFLTDFLYLQ EVYVDLTHSY GGPIELGEHW ATP                         103
//

If you have problems or comments...

PBIL Back to PBIL home page