(data stored in ACNUC27125 zone)

EMBL: CP000828.PE278

CP000828.PE278       Location/Qualifiers
FT   CDS             281259..282101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0283"
FT                   /product="glycosyl transferase WecB/TagA/CpsF family
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25369"
FT                   /db_xref="GOA:B0C8X9"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8X9"
FT                   /protein_id="ABW25369.1"
FT                   /translation="MSLPQPKVLLKPTSAAQMNKSLPEQQVLNSSITALRLNKSMRTIM
FT                   QWAHGGESKSVCVANVHMLMEAYWHDKFSQVLQNADMVTPDGMPLVWMMKLLGRKGQDR
FT                   VAGMDILQSLCQKASEEKVRVFFLGSQKSILDRMRARLEKEYPNLEIAAMKPLPFRPLT
FT                   AAEDQELIEEIHESGAGIVFLSLGCPKQEKWMAEHQGRVQAVMIGLGGAFPVYAGLKKW
FT                   APRWVRQAGLEWLYRLVQEPKRLIGRYTQTIPPFIFLASVQLVAHHLAPKRLLNAFNL"
     MSLPQPKVLL KPTSAAQMNK SLPEQQVLNS SITALRLNKS MRTIMQWAHG GESKSVCVAN        60
     VHMLMEAYWH DKFSQVLQNA DMVTPDGMPL VWMMKLLGRK GQDRVAGMDI LQSLCQKASE       120
     EKVRVFFLGS QKSILDRMRA RLEKEYPNLE IAAMKPLPFR PLTAAEDQEL IEEIHESGAG       180
     IVFLSLGCPK QEKWMAEHQG RVQAVMIGLG GAFPVYAGLK KWAPRWVRQA GLEWLYRLVQ       240
     EPKRLIGRYT QTIPPFIFLA SVQLVAHHLA PKRLLNAFNL                             280
//

If you have problems or comments...

PBIL Back to PBIL home page