(data stored in ACNUC8465 zone)

EMBL: CP000828.PE280

CP000828.PE280       Location/Qualifiers
FT   CDS             complement(284694..285965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0285"
FT                   /product="two-component hybrid histidine kinase sensor and
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25371"
FT                   /db_xref="GOA:B0C8Y1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8Y1"
FT                   /protein_id="ABW25371.1"
FT                   /translation="MAKSLKSKQTKPEQEGERSSTALPQEGEIIRVLLVEDNPGDAFLI
FT                   QGMLGVKRSEDAVQYEITHVDKLEDALQTLAKKDFNVVLLDLSLPDSHGLTTLEKVVAQ
FT                   SPVLPIVVFTGLDDETVAMQAVQQGAQDFLVKGQVTPGSLIHAIRYSIERQQNELALKQ
FT                   KTIELERLNKELRKRSLELEAANTELEAFNYTVSHDLRNPLTGIKTGCALLTAYMGDED
FT                   PRLQKYLGTIQDYTRHMATLLEGLLQLSNIGRNPIQAQVVNLSSTVQTIARQLLQQEPK
FT                   RNVKFVIEPQVNVEGDTHLLWVALENLLGNAWKYTGALEHAQIEFGKTTLTHVSRQPLN
FT                   AAETIAPNQPIYFVKDNGAGFDMSHAERIFLPFQRLTNSEDFSGSGIGLSTVQRIIHCH
FT                   GGQIWFDAVVNQGATFYWTLAYKQ"
     MAKSLKSKQT KPEQEGERSS TALPQEGEII RVLLVEDNPG DAFLIQGMLG VKRSEDAVQY        60
     EITHVDKLED ALQTLAKKDF NVVLLDLSLP DSHGLTTLEK VVAQSPVLPI VVFTGLDDET       120
     VAMQAVQQGA QDFLVKGQVT PGSLIHAIRY SIERQQNELA LKQKTIELER LNKELRKRSL       180
     ELEAANTELE AFNYTVSHDL RNPLTGIKTG CALLTAYMGD EDPRLQKYLG TIQDYTRHMA       240
     TLLEGLLQLS NIGRNPIQAQ VVNLSSTVQT IARQLLQQEP KRNVKFVIEP QVNVEGDTHL       300
     LWVALENLLG NAWKYTGALE HAQIEFGKTT LTHVSRQPLN AAETIAPNQP IYFVKDNGAG       360
     FDMSHAERIF LPFQRLTNSE DFSGSGIGLS TVQRIIHCHG GQIWFDAVVN QGATFYWTLA       420
     YKQ                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page