(data stored in ACNUC27125 zone)

EMBL: CP000828.PE283

CP000828.PE283       Location/Qualifiers
FT   CDS             288736..289254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0288"
FT                   /product="HNH endonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25374"
FT                   /db_xref="GOA:B0C8Y4"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8Y4"
FT                   /protein_id="ABW25374.1"
FT                   /translation="MTVIQPILQNTVVVFSKAYLPLARINIKRAIVLLITGQAESLDFG
FT                   NTQVWEVRSPNQVLRVSEHIRLLMGNPERMWKIPPVNRREVLKRDQHRCQYCGSHRRLT
FT                   LDHVIPRSKGGLHTWDNVVAACEPCNSTKSDRTPTQAGMTLQSKPKAPIHPAVAFADQF
FT                   WKSQENLTH"
     MTVIQPILQN TVVVFSKAYL PLARINIKRA IVLLITGQAE SLDFGNTQVW EVRSPNQVLR        60
     VSEHIRLLMG NPERMWKIPP VNRREVLKRD QHRCQYCGSH RRLTLDHVIP RSKGGLHTWD       120
     NVVAACEPCN STKSDRTPTQ AGMTLQSKPK APIHPAVAFA DQFWKSQENL TH               172
//

If you have problems or comments...

PBIL Back to PBIL home page