(data stored in ACNUC27125 zone)

EMBL: CP000828.PE288

CP000828.PE288       Location/Qualifiers
FT   CDS             293486..294106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25379"
FT                   /db_xref="UniProtKB/TrEMBL:B0C8Y9"
FT                   /protein_id="ABW25379.1"
FT                   /translation="MKIKTISILALLMIGMTVNMPSIAQYSRTRYGVDVELYTFVDSYN
FT                   PRQNQESGDIEIKITNKTDKKIELPSQYDGSAISLFALQETEDPRARVMDQHLIVRNAT
FT                   SRPKKKFLSPGETYSYGKLPLNRIFDKEIIGSEGKYYWNWLLHAPPKATPIYDNKWEFE
FT                   ADKLVDTVVLWAEVKIGDQITRSTPKIISIQNQEFNEPEVEAD"
     MKIKTISILA LLMIGMTVNM PSIAQYSRTR YGVDVELYTF VDSYNPRQNQ ESGDIEIKIT        60
     NKTDKKIELP SQYDGSAISL FALQETEDPR ARVMDQHLIV RNATSRPKKK FLSPGETYSY       120
     GKLPLNRIFD KEIIGSEGKY YWNWLLHAPP KATPIYDNKW EFEADKLVDT VVLWAEVKIG       180
     DQITRSTPKI ISIQNQEFNE PEVEAD                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page