(data stored in ACNUC5340 zone)

EMBL: CP000828.PE29

CP000828.PE29        Location/Qualifiers
FT   CDS             35158..35352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25120"
FT                   /db_xref="GOA:B0C508"
FT                   /db_xref="UniProtKB/TrEMBL:B0C508"
FT                   /protein_id="ABW25120.1"
FT                   /translation="MQAQKSQQRSSMLEGRCWLRYLRFIFRAFIGLAPIIYVYILTNIS
FT                   LFCDFYNIYFIFLLSMTFL"
     MQAQKSQQRS SMLEGRCWLR YLRFIFRAFI GLAPIIYVYI LTNISLFCDF YNIYFIFLLS        60
     MTFL                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page