(data stored in ACNUC27125 zone)

EMBL: CP000828.PE291

CP000828.PE291       Location/Qualifiers
FT   CDS             295903..296184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25382"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9U2"
FT                   /protein_id="ABW25382.1"
FT                   /translation="MRERIQRYNIVCGVVNSETSGYHETITQFYLKVIVYFLEQHDVSQ
FT                   SIDQLAESLIQAWGNRNLPLSYYSKDRLMSKEARQHWVEPDLARMPGA"
     MRERIQRYNI VCGVVNSETS GYHETITQFY LKVIVYFLEQ HDVSQSIDQL AESLIQAWGN        60
     RNLPLSYYSK DRLMSKEARQ HWVEPDLARM PGA                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page