(data stored in ACNUC5340 zone)

EMBL: CP000828.PE292

CP000828.PE292       Location/Qualifiers
FT   CDS             296509..297024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0319"
FT                   /product="appr-1-p processing enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25383"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9U3"
FT                   /protein_id="ABW25383.1"
FT                   /translation="MDTRTEIVQTDITTLKVDAIVNAANESLLGGGGVDGAIHRTAGPQ
FT                   LLAECRTLKGCKTGHAKLTKGYQLPAKYVIHTVGPIWRGGGANEAILLQACYQRSLALA
FT                   VDNGIQTIAFPAISCGVYGYPIDQACQIAFETTLNFLQMNQSITQVIFACFGDLIYHTY
FT                   LKIGEQVN"
     MDTRTEIVQT DITTLKVDAI VNAANESLLG GGGVDGAIHR TAGPQLLAEC RTLKGCKTGH        60
     AKLTKGYQLP AKYVIHTVGP IWRGGGANEA ILLQACYQRS LALAVDNGIQ TIAFPAISCG       120
     VYGYPIDQAC QIAFETTLNF LQMNQSITQV IFACFGDLIY HTYLKIGEQV N                171
//

If you have problems or comments...

PBIL Back to PBIL home page