(data stored in ACNUC5340 zone)

EMBL: CP000828.PE293

CP000828.PE293       Location/Qualifiers
FT   CDS             complement(298984..299148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25384"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9U4"
FT                   /protein_id="ABW25384.1"
FT                   /translation="MGTPNFLDVIVVHKRFFDAEPSDVPNSTRFDIPSGGNINRVLLVC
FT                   DWIKDGLLR"
     MGTPNFLDVI VVHKRFFDAE PSDVPNSTRF DIPSGGNINR VLLVCDWIKD GLLR              54
//

If you have problems or comments...

PBIL Back to PBIL home page