(data stored in ACNUC5340 zone)

EMBL: CP000828.PE296

CP000828.PE296       Location/Qualifiers
FT   CDS             299957..300697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25387"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9U7"
FT                   /protein_id="ABW25387.1"
FT                   /translation="MSEHRLSEITIERPRGGMRRSLRKVKGARKQLDRLTEVATEDGLL
FT                   SPYLIKPRGKTKWLSDHLGPLRRFLKSHVGQPWDDVYSKLCRRLKTNTMAGQHVLSHVW
FT                   DFVELHVEIMDGVLYHKPYWGSFQPLDYRCYRDKFYVHPETRILCAVEKKPRKRQRQRP
FT                   PSDRVVIDAYHEYQQLNELWYLITYEDFPPFPVMTVRDVLRGEIPRQTRYGNINTRYAV
FT                   KKKQCNKKEIRFILSQIKAVKPTS"
     MSEHRLSEIT IERPRGGMRR SLRKVKGARK QLDRLTEVAT EDGLLSPYLI KPRGKTKWLS        60
     DHLGPLRRFL KSHVGQPWDD VYSKLCRRLK TNTMAGQHVL SHVWDFVELH VEIMDGVLYH       120
     KPYWGSFQPL DYRCYRDKFY VHPETRILCA VEKKPRKRQR QRPPSDRVVI DAYHEYQQLN       180
     ELWYLITYED FPPFPVMTVR DVLRGEIPRQ TRYGNINTRY AVKKKQCNKK EIRFILSQIK       240
     AVKPTS                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page