(data stored in ACNUC5340 zone)

EMBL: CP000828.PE298

CP000828.PE298       Location/Qualifiers
FT   CDS             301774..303201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25389"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037214"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9U9"
FT                   /protein_id="ABW25389.1"
FT                   /translation="MNTAEQDLRLEMLNSLLTTPHRKLEQVAETHQLMVEVDPLFYGHL
FT                   AVWYQRYGDVRDHKEVFVSHLLTSGMADHRGAGFVLLQGLPPYQVARVIDFMKQKLGKV
FT                   PRSTRTAVRRYLTRREQNPKQFDRAALRARKAIKHLYATLHIKPGARADAILFKNDPPD
FT                   GSLAKVLKQIANAPHPSEQARLIVEFKIPYAIATGSIQQLTPTVLAALIHNMSPQEVIN
FT                   HLKSLKARGAMDHAEMKQLIDDKLGKAQTDTRISAFKAQVAAEAVDVDAETTAKLEKVT
FT                   DKQVKRRGTIGKSTALLVDKSGSMSSAIEVGKRLAAMISGISQADLFVYAFDTIPYPVQ
FT                   SQGSDLSDWERAFKLIKAGGGTSLGCALEVMCQHQQKVDQIILVTDEGGNTTPYFAETY
FT                   QRYCREFGLLPNVVIVRVGHAYKLVENQLRQQQAPVETFTFQGDYYALPNLVPLLTRPS
FT                   RLELLMEIMETPLPIRY"
     MNTAEQDLRL EMLNSLLTTP HRKLEQVAET HQLMVEVDPL FYGHLAVWYQ RYGDVRDHKE        60
     VFVSHLLTSG MADHRGAGFV LLQGLPPYQV ARVIDFMKQK LGKVPRSTRT AVRRYLTRRE       120
     QNPKQFDRAA LRARKAIKHL YATLHIKPGA RADAILFKND PPDGSLAKVL KQIANAPHPS       180
     EQARLIVEFK IPYAIATGSI QQLTPTVLAA LIHNMSPQEV INHLKSLKAR GAMDHAEMKQ       240
     LIDDKLGKAQ TDTRISAFKA QVAAEAVDVD AETTAKLEKV TDKQVKRRGT IGKSTALLVD       300
     KSGSMSSAIE VGKRLAAMIS GISQADLFVY AFDTIPYPVQ SQGSDLSDWE RAFKLIKAGG       360
     GTSLGCALEV MCQHQQKVDQ IILVTDEGGN TTPYFAETYQ RYCREFGLLP NVVIVRVGHA       420
     YKLVENQLRQ QQAPVETFTF QGDYYALPNL VPLLTRPSRL ELLMEIMETP LPIRY            475
//

If you have problems or comments...

PBIL Back to PBIL home page