(data stored in ACNUC27125 zone)

EMBL: CP000828.PE299

CP000828.PE299       Location/Qualifiers
FT   CDS             complement(303316..303885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25390"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9V0"
FT                   /protein_id="ABW25390.1"
FT                   /translation="MTTILLNLEPIATSLTHEQFYELCMANKDIAMERSPQGKLIIMPL
FT                   VGGERGRDEARHIARLVVWNDQARLGEVFSSSTVFKLPKGGDRSPDAAWVVQERWETLT
FT                   QDQQKKFPPLCPDFVIELRSESDRLKLLQAKMQEYLDSGLRLGWLIDPQNQTVEIYRFG
FT                   QEVEVLDLPTTLSGEDILPGFSMAVE"
     MTTILLNLEP IATSLTHEQF YELCMANKDI AMERSPQGKL IIMPLVGGER GRDEARHIAR        60
     LVVWNDQARL GEVFSSSTVF KLPKGGDRSP DAAWVVQERW ETLTQDQQKK FPPLCPDFVI       120
     ELRSESDRLK LLQAKMQEYL DSGLRLGWLI DPQNQTVEIY RFGQEVEVLD LPTTLSGEDI       180
     LPGFSMAVE                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page