(data stored in ACNUC5340 zone)

EMBL: CP000828.PE305

CP000828.PE305       Location/Qualifiers
FT   CDS             complement(310211..310345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25396"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9V6"
FT                   /protein_id="ABW25396.1"
FT                   /translation="MALLNLQTQRVENDRLNFIKAIFLLIPGDFFDLSNAIIPSLKEF"
     MALLNLQTQR VENDRLNFIK AIFLLIPGDF FDLSNAIIPS LKEF                         44
//

If you have problems or comments...

PBIL Back to PBIL home page